Lineage for d2jn6a1 (2jn6 A:1-89)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1720411Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1721260Family a.4.1.19: Cgl2762-like [158260] (1 protein)
    Pfam PF01527; Transposase 8
  6. 1721261Protein Uncharacterized protein Cgl2762 [158261] (1 species)
  7. 1721262Species Corynebacterium glutamicum [TaxId:1718] [158262] (1 PDB entry)
    Uniprot Q8NM20 1-89
  8. 1721263Domain d2jn6a1: 2jn6 A:1-89 [148144]

Details for d2jn6a1

PDB Entry: 2jn6 (more details)

PDB Description: solution nmr structure of protein cgl2762 from corynebacterium glutamicum: northeast structural genomics consortium target cgr3
PDB Compounds: (A:) Protein Cgl2762

SCOPe Domain Sequences for d2jn6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jn6a1 a.4.1.19 (A:1-89) Uncharacterized protein Cgl2762 {Corynebacterium glutamicum [TaxId: 1718]}
mptktyseefkrdavalyensdgaslqqiandlginrvtlknwiikygsnhnvqgttpsa
avseaeqirqlkkenalqrartrhpaesc

SCOPe Domain Coordinates for d2jn6a1:

Click to download the PDB-style file with coordinates for d2jn6a1.
(The format of our PDB-style files is described here.)

Timeline for d2jn6a1: