| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
| Family a.4.1.19: Cgl2762-like [158260] (1 protein) Pfam PF01527; Transposase 8 |
| Protein Uncharacterized protein Cgl2762 [158261] (1 species) |
| Species Corynebacterium glutamicum [TaxId:1718] [158262] (1 PDB entry) Uniprot Q8NM20 1-89 |
| Domain d2jn6a1: 2jn6 A:1-89 [148144] Other proteins in same PDB: d2jn6a2 |
PDB Entry: 2jn6 (more details)
SCOPe Domain Sequences for d2jn6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jn6a1 a.4.1.19 (A:1-89) Uncharacterized protein Cgl2762 {Corynebacterium glutamicum [TaxId: 1718]}
mptktyseefkrdavalyensdgaslqqiandlginrvtlknwiikygsnhnvqgttpsa
avseaeqirqlkkenalqrartrhpaesc
Timeline for d2jn6a1: