Lineage for d2jn0a1 (2jn0 A:4-53)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798178Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 798179Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (6 families) (S)
  5. 798499Family b.38.1.6: YgdI/YgdR-like [159052] (6 proteins)
    Pfam PF06004; DUF903, putative lipoprotein; both homohexameric and homoheptameric ring assemblies are observed in the crystals
  6. 798500Protein Hypothetical lipoprotein YgdR [159063] (1 species)
  7. 798501Species Escherichia coli [TaxId:562] [159064] (1 PDB entry)
    Uniprot P65294 23-72
  8. 798502Domain d2jn0a1: 2jn0 A:4-53 [148141]

Details for d2jn0a1

PDB Entry: 2jn0 (more details)

PDB Description: solution nmr structure of the ygdr protein from escherichia coli. northeast structural genomics target er382a.
PDB Compounds: (A:) Hypothetical lipoprotein ygdR

SCOP Domain Sequences for d2jn0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jn0a1 b.38.1.6 (A:4-53) Hypothetical lipoprotein YgdR {Escherichia coli [TaxId: 562]}
dyvmatkdgrmiltdgkpeidddtglvsyhdqqgnamqinrddvsqiier

SCOP Domain Coordinates for d2jn0a1:

Click to download the PDB-style file with coordinates for d2jn0a1.
(The format of our PDB-style files is described here.)

Timeline for d2jn0a1: