Lineage for d2jmua1 (2jmu A:2-224)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1655796Fold d.63: CYTH-like phosphatases [55153] (1 superfamily)
    duplication of beta-alpha-beta(3) motif: antiparallel beta sheet forms wide barrel (n=8, S=16) with a channel running through it
  4. 1655797Superfamily d.63.1: CYTH-like phosphatases [55154] (3 families) (S)
  5. 1655811Family d.63.1.2: CYTH domain [118007] (5 proteins)
    Pfam PF01928
  6. 1655824Protein Thiamine-triphosphatase (ThTPase) [160428] (2 species)
  7. 1655830Species Mouse (Mus musculus) [TaxId:10090] [160429] (1 PDB entry)
    Uniprot Q8JZL3 2-224
  8. 1655831Domain d2jmua1: 2jmu A:2-224 [148140]

Details for d2jmua1

PDB Entry: 2jmu (more details)

PDB Description: nmr structure of the mouse thiamine triphosphatase
PDB Compounds: (A:) Thiamine-triphosphatase

SCOPe Domain Sequences for d2jmua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jmua1 d.63.1.2 (A:2-224) Thiamine-triphosphatase (ThTPase) {Mouse (Mus musculus) [TaxId: 10090]}
aqglieverkfapgpdteerlqelgatlehrvtfrdtyydtselslmlsdhwlrqregsg
welkcpgvtgvsgphneyvevtseaaivaqlfellgsgeqkpagvaavlgslklqevasf
ittrsswklalsgahgqepqltidldsadfgyavgeveamvhekaevpaalekiitvssm
lgvpaqeeapaklmvylqrfrpldyqrlleaassgeatgdsas

SCOPe Domain Coordinates for d2jmua1:

Click to download the PDB-style file with coordinates for d2jmua1.
(The format of our PDB-style files is described here.)

Timeline for d2jmua1: