Lineage for d2jmfa_ (2jmf A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2811242Fold b.72: WW domain-like [51044] (3 superfamilies)
    core: 3-stranded meander beta-sheet
  4. 2811243Superfamily b.72.1: WW domain [51045] (2 families) (S)
  5. 2811244Family b.72.1.1: WW domain [51046] (13 proteins)
  6. 2811340Protein automated matches [192459] (3 species)
    not a true protein
  7. 2811341Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255274] (1 PDB entry)
  8. 2811342Domain d2jmfa_: 2jmf A: [148139]
    automated match to d1jmqa_

Details for d2jmfa_

PDB Entry: 2jmf (more details)

PDB Description: solution structure of the su(dx) ww4- notch py peptide complex
PDB Compounds: (A:) E3 ubiquitin-protein ligase suppressor of deltex

SCOPe Domain Sequences for d2jmfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jmfa_ b.72.1.1 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
vslinegplppgweirytaagerffvdhntrrttfedprpgap

SCOPe Domain Coordinates for d2jmfa_:

Click to download the PDB-style file with coordinates for d2jmfa_.
(The format of our PDB-style files is described here.)

Timeline for d2jmfa_: