Class b: All beta proteins [48724] (180 folds) |
Fold b.72: WW domain-like [51044] (3 superfamilies) core: 3-stranded meander beta-sheet |
Superfamily b.72.1: WW domain [51045] (2 families) |
Family b.72.1.1: WW domain [51046] (13 proteins) |
Protein automated matches [192459] (3 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255274] (1 PDB entry) |
Domain d2jmfa_: 2jmf A: [148139] automated match to d1jmqa_ |
PDB Entry: 2jmf (more details)
SCOPe Domain Sequences for d2jmfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jmfa_ b.72.1.1 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} vslinegplppgweirytaagerffvdhntrrttfedprpgap
Timeline for d2jmfa_: