![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.69.1: Galactose oxidase, central domain [50965] (2 families) ![]() |
![]() | Family b.69.1.1: Galactose oxidase, central domain [50966] (2 proteins) |
![]() | Protein Galactose oxidase, central domain [50967] (3 species) N-terminal domain is a jelly-roll sandwich C-terminal domain is Immunoglobulin-like |
![]() | Species Fusarium graminearum (Gibberella zeae) [TaxId:5518] [159255] (6 PDB entries) |
![]() | Domain d2jkxa3: 2jkx A:151-537 [148138] Other proteins in same PDB: d2jkxa1, d2jkxa2 automated match to d1gofa3 complexed with act, ca |
PDB Entry: 2jkx (more details), 1.84 Å
SCOPe Domain Sequences for d2jkxa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jkxa3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fusarium graminearum (Gibberella zeae) [TaxId: 5518]} ytapqpglgrwgptidlpivpaaaaieptsgrvlmwssyrndafggspggitltsswdps tgivsdrtvtvtkhdmfcpgismdgngqivvtggndakktslydsssdswipgpdmqvar gyqssatmsdgrvftiggswsggvfekngevyspssktwtslpnakvnpmltadkqglyr sdnhawlfgwkkgsvfqagpstamnwyytsgsgdvksagkrqsnrgvapdamcgnavmyd avkgkiltfggspdyqdsdattnahiitlgepgtspntvfasnglyfartfhtsvvlpdg stfitggqrrgipfedstpvftpeiyvpeqdtfykqnpnsivrvyhsislllpdgrvfng ggglcgdcttnhfdaqiftpnylynsn
Timeline for d2jkxa3: