Lineage for d2jkxa3 (2jkx A:151-537)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1803012Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 1803013Superfamily b.69.1: Galactose oxidase, central domain [50965] (2 families) (S)
  5. 1803014Family b.69.1.1: Galactose oxidase, central domain [50966] (2 proteins)
  6. 1803015Protein Galactose oxidase, central domain [50967] (3 species)
    N-terminal domain is a jelly-roll sandwich
    C-terminal domain is Immunoglobulin-like
  7. 1803023Species Fusarium graminearum (Gibberella zeae) [TaxId:5518] [159255] (6 PDB entries)
  8. 1803024Domain d2jkxa3: 2jkx A:151-537 [148138]
    Other proteins in same PDB: d2jkxa1, d2jkxa2
    automated match to d1gofa3
    complexed with act, ca

Details for d2jkxa3

PDB Entry: 2jkx (more details), 1.84 Å

PDB Description: galactose oxidase. matgo. copper free, expressed in pichia pastoris.
PDB Compounds: (A:) Galactose oxidase

SCOPe Domain Sequences for d2jkxa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jkxa3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fusarium graminearum (Gibberella zeae) [TaxId: 5518]}
ytapqpglgrwgptidlpivpaaaaieptsgrvlmwssyrndafggspggitltsswdps
tgivsdrtvtvtkhdmfcpgismdgngqivvtggndakktslydsssdswipgpdmqvar
gyqssatmsdgrvftiggswsggvfekngevyspssktwtslpnakvnpmltadkqglyr
sdnhawlfgwkkgsvfqagpstamnwyytsgsgdvksagkrqsnrgvapdamcgnavmyd
avkgkiltfggspdyqdsdattnahiitlgepgtspntvfasnglyfartfhtsvvlpdg
stfitggqrrgipfedstpvftpeiyvpeqdtfykqnpnsivrvyhsislllpdgrvfng
ggglcgdcttnhfdaqiftpnylynsn

SCOPe Domain Coordinates for d2jkxa3:

Click to download the PDB-style file with coordinates for d2jkxa3.
(The format of our PDB-style files is described here.)

Timeline for d2jkxa3: