Lineage for d2jk2a_ (2jk2 A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) 
Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
automatically mapped to Pfam PF00121Protein Triosephosphate isomerase [51353] (21 species) 
Species Human (Homo sapiens) [TaxId:9606] [51355] (15 PDB entries) 
Domain d2jk2a_: 2jk2 A: [148134]
automated match to d1htia_
Details for d2jk2a_
PDB Entry: 2jk2 (more details), 1.7 Å
PDB Description: structural basis of human triosephosphate isomerase deficiency. crystal structure of the wild type enzyme.
PDB Compounds: (A:) triosephosphate isomeraseSCOPe Domain Sequences for d2jk2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jk2a_ c.1.1.1 (A:) Triosephosphate isomerase {Human (Homo sapiens) [TaxId: 9606]}
rkffvggnwkmngrkqslgeligtlnaakvpadtevvcapptayidfarqkldpkiavaa
qncykvtngaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalaeglgv
iacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatpqqaqe
vheklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflvggaslkpefvdi
inakq
SCOPe Domain Coordinates for d2jk2a_:
Click to download the PDB-style file with coordinates for d2jk2a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2jk2a_:
- d2jk2a_ first appeared in SCOP 1.75, called d2jk2a1
- d2jk2a_ appears in SCOPe 2.07
View in 3D
