Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
Protein Deoxyribonucleoside kinase [69478] (1 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [69479] (11 PDB entries) |
Domain d2jj8b1: 2jj8 B:12-208 [148130] automatically matched to d1oe0a_ complexed with azz, so4 |
PDB Entry: 2jj8 (more details), 2.8 Å
SCOPe Domain Sequences for d2jj8b1:
Sequence, based on SEQRES records: (download)
>d2jj8b1 c.37.1.1 (B:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} tkyaegtqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvnllelmyk dpkkwampfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmynt leewykfieesihvqadliiylrtspevayerirqrarseescvplkylqelhelhedwl ihqrrpqsckvlvldad
>d2jj8b1 c.37.1.1 (B:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} tkyaegtqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvnllelmyk dpkkwampfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmynt leewykfieesihvqadliiylrtspevayerirqrcvplkylqelhelhedwlihqckv lvldad
Timeline for d2jj8b1: