Lineage for d2jj0l_ (2jj0 L:)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1060394Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 1060395Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
  5. 1060396Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 1060540Protein automated matches [190224] (5 species)
    not a true protein
  7. 1060552Species Rhodobacter sphaeroides [TaxId:1063] [186985] (29 PDB entries)
  8. 1060604Domain d2jj0l_: 2jj0 L: [148122]
    automated match to d1aigl_
    complexed with bcl, bph, cdl, cl, fe, spn, u10; mutant

Details for d2jj0l_

PDB Entry: 2jj0 (more details), 2.8 Å

PDB Description: photosynthetic reaction center mutant with ala m248 replaced with trp (chain m, am248w)
PDB Compounds: (L:) reaction center protein l chain

SCOPe Domain Sequences for d2jj0l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jj0l_ f.26.1.1 (L:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

SCOPe Domain Coordinates for d2jj0l_:

Click to download the PDB-style file with coordinates for d2jj0l_.
(The format of our PDB-style files is described here.)

Timeline for d2jj0l_: