SCOP 1.75: Domain d2jj0l1: 2jj0 L:1-281

Lineage for d2jj0l1 (2jj0 L:1-281)

1. Root: SCOP 1.75

2. Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (4 proteins)
   L and M are probably related to each other

6. Protein L (light) subunit [81477] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81475] (67 PDB entries)
   Uniprot P02954

8. Domain d2jj0l1: 2jj0 L:1-281 [148122]
   automatically matched to d1aigl_
   complexed with bcl, bph, cdl, cl, fe, spn, u10; mutant

Details for d2jj0l1

PDB Entry: 2jj0, 2.8 Å

PDB Description: photosynthetic reaction center mutant with ala m248 replaced with trp (chain m, am248w)

PDB Compounds: (L:) reaction center protein l chain

SCOP Domain Sequences for d2jj0l1:

Sequence; same for both SEQRES and ATOM records:

>d2jj0l1 f.26.1.1 (L:1-281) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

Timeline for d2jj0l1:

• d2jj0l1 is new in SCOP 1.75
  
• d2jj0l1 is called d2jj0l_ in SCOPe 2.01
  
• d2jj0l1 appears in the current release, SCOPe 2.08, called d2jj0l_