Lineage for d2jizg1 (2jiz G:1-272)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 897676Fold i.3: ATP synthase [58140] (1 superfamily)
  4. 897677Superfamily i.3.1: ATP synthase [58141] (1 family) (S)
  5. 897678Family i.3.1.1: ATP synthase [58142] (1 protein)
  6. 897679Protein ATP synthase [58143] (3 species)
  7. 897699Species Cow (Bos taurus) [TaxId:9913] [161283] (4 PDB entries)
  8. 897700Domain d2jizg1: 2jiz G:1-272 [148120]
    automatically matched to d1qo1g_

Details for d2jizg1

PDB Entry: 2jiz (more details), 2.3 Å

PDB Description: the structure of f1-atpase inhibited by resveratrol.
PDB Compounds: (G:) ATP synthase gamma chain

SCOP Domain Sequences for d2jizg1:

Sequence, based on SEQRES records: (download)

>d2jizg1 i.3.1.1 (G:1-272) ATP synthase {Cow (Bos taurus) [TaxId: 9913]}
atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgslalyekadiktp
edkkkhliigvssdrglcgaihssvakqmkseaanlaaagkevkiigvgdkirsilhrth
sdqflvtfkevgrrpptfgdasvialellnsgyefdegsiifnrfrsvisykteekpifs
ldtissaesmsiyddidadvlrnyqeyslaniiyyslkesttseqsarmtamdnasknas
emidkltltfnrtrqavitkelieiisgaaal

Sequence, based on observed residues (ATOM records): (download)

>d2jizg1 i.3.1.1 (G:1-272) ATP synthase {Cow (Bos taurus) [TaxId: 9913]}
atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgliigvssdrglcg
aihssvakqmkiigvgdkirsiltfkevgrrpptfgdasvialelsiifnrfrsvisykt
lrnyqeyslaniiyyslkesttseqsarmtamdnasknasemidkltltfnrtrqavitk
elieiisgaaal

SCOP Domain Coordinates for d2jizg1:

Click to download the PDB-style file with coordinates for d2jizg1.
(The format of our PDB-style files is described here.)

Timeline for d2jizg1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2jizn1