Lineage for d2jiyl_ (2jiy L:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027280Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 3027281Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 3027282Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 3027502Protein automated matches [190224] (17 species)
    not a true protein
  7. 3027525Species Rhodobacter sphaeroides [TaxId:1063] [186985] (34 PDB entries)
  8. 3027528Domain d2jiyl_: 2jiy L: [148119]
    Other proteins in same PDB: d2jiyh1, d2jiyh2
    automated match to d1aigl_
    complexed with bcl, bph, cdl, cl, d12, fe, lda, po4, spn, u10; mutant

Details for d2jiyl_

PDB Entry: 2jiy (more details), 2.2 Å

PDB Description: photosynthetic reaction center mutant with ala m149 replaced with trp (chain m, am149w)
PDB Compounds: (L:) reaction center protein l chain

SCOPe Domain Sequences for d2jiyl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jiyl_ f.26.1.1 (L:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

SCOPe Domain Coordinates for d2jiyl_:

Click to download the PDB-style file with coordinates for d2jiyl_.
(The format of our PDB-style files is described here.)

Timeline for d2jiyl_: