SCOP 1.75: Domain d2jixh2: 2jix H:117-217

Lineage for d2jixh2 (2jix H:117-217)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)

7. Species Escherichia coli [TaxId:562] [158873] (1 PDB entry)

8. Domain d2jixh2: 2jix H:117-217 [148118]
   Other proteins in same PDB: d2jixb1, d2jixb2, d2jixc1, d2jixc2, d2jixd1, d2jixe1, d2jixe2, d2jixf1, d2jixh1
   automatically matched to d1h3ph2

Details for d2jixh2

PDB Entry: 2jix, 3.2 Å

PDB Description: crystal structure of abt-007 fab fragment with the soluble domain of epo receptor

PDB Compounds: (H:) abt-007 fab fragment

SCOP Domain Sequences for d2jixh2:

Sequence; same for both SEQRES and ATOM records:

>d2jixh2 b.1.1.2 (H:117-217) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Escherichia coli [TaxId: 562]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Timeline for d2jixh2:

• d2jixh2 is new in SCOP 1.75
  
• d2jixh2 appears in SCOPe 2.01
  
• d2jixh2 appears in the current release, SCOPe 2.08