![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species) |
![]() | Species Escherichia coli [TaxId:562] [158873] (1 PDB entry) |
![]() | Domain d2jixh2: 2jix H:117-217 [148118] Other proteins in same PDB: d2jixb1, d2jixb2, d2jixc1, d2jixc2, d2jixd1, d2jixe1, d2jixe2, d2jixf1, d2jixh1 automatically matched to d1h3ph2 |
PDB Entry: 2jix (more details), 3.2 Å
SCOP Domain Sequences for d2jixh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jixh2 b.1.1.2 (H:117-217) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Escherichia coli [TaxId: 562]} astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
Timeline for d2jixh2: