Lineage for d2jixh2 (2jix H:117-217)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 785070Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)
  7. 785071Species Escherichia coli [TaxId:562] [158873] (1 PDB entry)
  8. 785074Domain d2jixh2: 2jix H:117-217 [148118]
    Other proteins in same PDB: d2jixb1, d2jixb2, d2jixc1, d2jixc2, d2jixd1, d2jixe1, d2jixe2, d2jixf1, d2jixh1
    automatically matched to d1h3ph2

Details for d2jixh2

PDB Entry: 2jix (more details), 3.2 Å

PDB Description: Crystal structure of ABT-007 FAB fragment with the soluble domain of EPO receptor
PDB Compounds: (H:) abt-007 fab fragment

SCOP Domain Sequences for d2jixh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jixh2 b.1.1.2 (H:117-217) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Escherichia coli [TaxId: 562]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

SCOP Domain Coordinates for d2jixh2:

Click to download the PDB-style file with coordinates for d2jixh2.
(The format of our PDB-style files is described here.)

Timeline for d2jixh2: