Lineage for d2jixh2 (2jix H:117-217)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2747669Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)
  7. 2747676Species Human (Homo sapiens) [TaxId:9606] [88575] (173 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody
  8. 2747933Domain d2jixh2: 2jix H:117-217 [148118]
    Other proteins in same PDB: d2jixb1, d2jixb2, d2jixc1, d2jixc2, d2jixd1, d2jixd3, d2jixe1, d2jixe2, d2jixf1, d2jixf3, d2jixh1, d2jixh3
    automatically matched to d1h3ph2

Details for d2jixh2

PDB Entry: 2jix (more details), 3.2 Å

PDB Description: crystal structure of abt-007 fab fragment with the soluble domain of epo receptor
PDB Compounds: (H:) abt-007 fab fragment

SCOPe Domain Sequences for d2jixh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jixh2 b.1.1.2 (H:117-217) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

SCOPe Domain Coordinates for d2jixh2:

Click to download the PDB-style file with coordinates for d2jixh2.
(The format of our PDB-style files is described here.)

Timeline for d2jixh2: