Lineage for d2jixh1 (2jix H:1-116)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 781740Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 781843Species Escherichia coli [TaxId:562] [158861] (1 PDB entry)
  8. 781846Domain d2jixh1: 2jix H:1-116 [148117]
    Other proteins in same PDB: d2jixb1, d2jixb2, d2jixc1, d2jixc2, d2jixd2, d2jixe1, d2jixe2, d2jixf2, d2jixh2
    automatically matched to d1h3ph1

Details for d2jixh1

PDB Entry: 2jix (more details), 3.2 Å

PDB Description: crystal structure of abt-007 fab fragment with the soluble domain of epo receptor
PDB Compounds: (H:) abt-007 fab fragment

SCOP Domain Sequences for d2jixh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jixh1 b.1.1.1 (H:1-116) Immunoglobulin heavy chain variable domain, VH {Escherichia coli [TaxId: 562]}
qvqlqesgpglvkpsetlsltctvsgasissyywswirqppgkglewigyiggegstnyn
pslksrvtisvdtsknqfslklrsvtaadtavyycarerlgigdywgqgtlvtvss

SCOP Domain Coordinates for d2jixh1:

Click to download the PDB-style file with coordinates for d2jixh1.
(The format of our PDB-style files is described here.)

Timeline for d2jixh1: