Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins) |
Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species) VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species |
Species Escherichia coli [TaxId:562] [158861] (1 PDB entry) |
Domain d2jixf1: 2jix F:1-116 [148115] Other proteins in same PDB: d2jixb1, d2jixb2, d2jixc1, d2jixc2, d2jixd2, d2jixe1, d2jixe2, d2jixf2, d2jixh2 automatically matched to d1h3ph1 |
PDB Entry: 2jix (more details), 3.2 Å
SCOP Domain Sequences for d2jixf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jixf1 b.1.1.1 (F:1-116) Immunoglobulin heavy chain variable domain, VH {Escherichia coli [TaxId: 562]} qvqlqesgpglvkpsetlsltctvsgasissyywswirqppgkglewigyiggegstnyn pslksrvtisvdtsknqfslklrsvtaadtavyycarerlgigdywgqgtlvtvss
Timeline for d2jixf1: