SCOPe 2.08: Domain d2jixc1: 2jix C:10-116

Lineage for d2jixc1 (2jix C:10-116)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Erythropoietin (EPO) receptor [49282] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49283] (6 PDB entries)

8. Domain d2jixc1: 2jix C:10-116 [148109]
   Other proteins in same PDB: d2jixd1, d2jixd2, d2jixd3, d2jixf1, d2jixf2, d2jixf3, d2jixh1, d2jixh2, d2jixh3
   automatically matched to d1ebaa1

Details for d2jixc1

PDB Entry: 2jix, 3.2 Å

PDB Description: crystal structure of abt-007 fab fragment with the soluble domain of epo receptor

PDB Compounds: (C:) erythropoietin receptor

SCOPe Domain Sequences for d2jixc1:

Sequence; same for both SEQRES and ATOM records:

>d2jixc1 b.1.2.1 (C:10-116) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]}
kfeskaallaargpeellcfterledlvcfweeaasagvgpgnysfsyqledepwklcrl
hqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihin

Timeline for d2jixc1:

• d2jixc1 first appeared in SCOP 1.75
  
• d2jixc1 appears in SCOPe 2.07