Lineage for d2jixb1 (2jix B:10-116)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 787437Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 787438Family b.1.2.1: Fibronectin type III [49266] (44 proteins)
    Pfam PF00041
  6. 787508Protein Erythropoietin (EPO) receptor [49282] (2 species)
  7. 787509Species Escherichia coli [TaxId:562] [158900] (1 PDB entry)
  8. 787510Domain d2jixb1: 2jix B:10-116 [148107]
    Other proteins in same PDB: d2jixd1, d2jixd2, d2jixf1, d2jixf2, d2jixh1, d2jixh2
    automatically matched to d1ebaa1

Details for d2jixb1

PDB Entry: 2jix (more details), 3.2 Å

PDB Description: Crystal structure of ABT-007 FAB fragment with the soluble domain of EPO receptor
PDB Compounds: (B:) erythropoietin receptor

SCOP Domain Sequences for d2jixb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jixb1 b.1.2.1 (B:10-116) Erythropoietin (EPO) receptor {Escherichia coli [TaxId: 562]}
kfeskaallaargpeellcfterledlvcfweeaasagvgpgnysfsyqledepwklcrl
hqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihin

SCOP Domain Coordinates for d2jixb1:

Click to download the PDB-style file with coordinates for d2jixb1.
(The format of our PDB-style files is described here.)

Timeline for d2jixb1: