Lineage for d2jixb1 (2jix B:10-116)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2761758Protein Erythropoietin (EPO) receptor [49282] (1 species)
  7. 2761759Species Human (Homo sapiens) [TaxId:9606] [49283] (6 PDB entries)
  8. 2761780Domain d2jixb1: 2jix B:10-116 [148107]
    Other proteins in same PDB: d2jixd1, d2jixd2, d2jixd3, d2jixf1, d2jixf2, d2jixf3, d2jixh1, d2jixh2, d2jixh3
    automatically matched to d1ebaa1

Details for d2jixb1

PDB Entry: 2jix (more details), 3.2 Å

PDB Description: crystal structure of abt-007 fab fragment with the soluble domain of epo receptor
PDB Compounds: (B:) erythropoietin receptor

SCOPe Domain Sequences for d2jixb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jixb1 b.1.2.1 (B:10-116) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]}
kfeskaallaargpeellcfterledlvcfweeaasagvgpgnysfsyqledepwklcrl
hqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihin

SCOPe Domain Coordinates for d2jixb1:

Click to download the PDB-style file with coordinates for d2jixb1.
(The format of our PDB-style files is described here.)

Timeline for d2jixb1: