| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
| Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
| Protein Erythropoietin (EPO) receptor [49282] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49283] (6 PDB entries) |
| Domain d2jixb1: 2jix B:10-116 [148107] Other proteins in same PDB: d2jixd1, d2jixd2, d2jixd3, d2jixf1, d2jixf2, d2jixf3, d2jixh1, d2jixh2, d2jixh3 automatically matched to d1ebaa1 |
PDB Entry: 2jix (more details), 3.2 Å
SCOPe Domain Sequences for d2jixb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jixb1 b.1.2.1 (B:10-116) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]}
kfeskaallaargpeellcfterledlvcfweeaasagvgpgnysfsyqledepwklcrl
hqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihin
Timeline for d2jixb1: