SCOPe 2.03: Domain d2jiwb3: 2jiw B:4-126

Lineage for d2jiwb3 (2jiw B:4-126)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families)
   contains similar fold but lacks its catalytic centre

5. Family d.92.2.3: Hyaluronidase N-terminal domain-like [143618] (2 proteins)

6. Protein Glucosaminidase GH84, N-terminal domain [143621] (1 species)

7. Species Bacteroides thetaiotaomicron [TaxId:818] [143622] (10 PDB entries)
   Uniprot Q89ZI2 25-147

8. Domain d2jiwb3: 2jiw B:4-126 [148106]
   Other proteins in same PDB: d2jiwa1, d2jiwa2, d2jiwb1, d2jiwb2
   automatically matched to 2J4G A:4-126
   complexed with beu

Details for d2jiwb3

PDB Entry: 2jiw, 1.95 Å

PDB Description: bacteroides thetaiotaomicron gh84 o-glcnacase in complex with 2-acetylamino-2-deoxy-1-epivalienamine

PDB Compounds: (B:) o-glcnacase bt_4395

SCOPe Domain Sequences for d2jiwb3:

Sequence; same for both SEQRES and ATOM records:

>d2jiwb3 d.92.2.3 (B:4-126) Glucosaminidase GH84, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]}
slqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgkqsskkgmlisigekg
dksvrkysrqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikd
yps

Timeline for d2jiwb3:

• d2jiwb3 first appeared in SCOP 1.75
  
• d2jiwb3 appears in SCOPe 2.02
  
• d2jiwb3 appears in SCOPe 2.04
  
• d2jiwb3 appears in the current release, SCOPe 2.08