![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) ![]() contains similar fold but lacks its catalytic centre |
![]() | Family d.92.2.3: Hyaluronidase N-terminal domain-like [143618] (2 proteins) |
![]() | Protein Glucosaminidase GH84, N-terminal domain [143621] (1 species) |
![]() | Species Bacteroides thetaiotaomicron [TaxId:818] [143622] (10 PDB entries) Uniprot Q89ZI2 25-147 |
![]() | Domain d2jiwb3: 2jiw B:4-126 [148106] Other proteins in same PDB: d2jiwa1, d2jiwa2, d2jiwb1, d2jiwb2 automatically matched to 2J4G A:4-126 complexed with beu |
PDB Entry: 2jiw (more details), 1.95 Å
SCOPe Domain Sequences for d2jiwb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jiwb3 d.92.2.3 (B:4-126) Glucosaminidase GH84, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} slqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgkqsskkgmlisigekg dksvrkysrqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikd yps
Timeline for d2jiwb3: