![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.10: alpha-D-glucuronidase/Hyaluronidase catalytic domain [82253] (4 proteins) Glycosyl hydrolase family 67, GH67; structurally related to GH20; contains extra C-terminal alpha-helical subdomain |
![]() | Protein automated matches [254553] (3 species) not a true protein |
![]() | Species Bacteroides thetaiotaomicron [TaxId:226186] [255268] (4 PDB entries) |
![]() | Domain d2jiwb2: 2jiw B:127-436 [148105] Other proteins in same PDB: d2jiwa1, d2jiwa3, d2jiwb1, d2jiwb3 automated match to d2choa2 complexed with beu |
PDB Entry: 2jiw (more details), 1.95 Å
SCOPe Domain Sequences for d2jiwb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jiwb2 c.1.8.10 (B:127-436) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]} vryrgvvegfygtpwshqarlsqlkfygknkmntyiygpkddpyhsapnwrlpypdkeaa qlqelvavanenevdfvwaihpgqdikwnkedrdlllakfekmyqlgvrsfavffddisg egtnpqkqaellnyidekfaqvkpdinqlvmcpteynkswsnpngnylttlgdklnpsiq imwtgdrvisditrdgiswinerikrpayiwwnfpvsdyvrdhlllgpvygndttiakem sgfvtnpmehaesskiaiysvasyawnpakydtwqtwkdairtilpsaaeelecfamhns dlgpnghgyr
Timeline for d2jiwb2: