SCOPe 2.06: Domain d2jiwb1: 2jiw B:437-593

Lineage for d2jiwb1 (2jiw B:437-593)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies)
   5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology

4. Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (2 families)

5. Family a.246.1.0: automated matches [254242] (1 protein)
   not a true family

6. Protein automated matches [254554] (2 species)
   not a true protein

7. Species Bacteroides thetaiotaomicron [TaxId:226186] [255269] (4 PDB entries)

8. Domain d2jiwb1: 2jiw B:437-593 [148104]
   Other proteins in same PDB: d2jiwa2, d2jiwa3, d2jiwb2, d2jiwb3
   automated match to d2choa1
   complexed with beu

Details for d2jiwb1

PDB Entry: 2jiw, 1.95 Å

PDB Description: bacteroides thetaiotaomicron gh84 o-glcnacase in complex with 2-acetylamino-2-deoxy-1-epivalienamine

PDB Compounds: (B:) o-glcnacase bt_4395

SCOPe Domain Sequences for d2jiwb1:

Sequence; same for both SEQRES and ATOM records:

>d2jiwb1 a.246.1.0 (B:437-593) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
reesmdiqpaaerflkafkegknydkadfetlqytfermkesadillmntenkpliveit
pwvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfyidqtsnqnpyqpgvkt
atrvikplidrtfatvvkffnqkfnahldattdymph

Timeline for d2jiwb1:

• d2jiwb1 first appeared in SCOP 1.75
  
• d2jiwb1 appears in SCOPe 2.05
  
• d2jiwb1 appears in SCOPe 2.07
  
• d2jiwb1 appears in the current release, SCOPe 2.08