Lineage for d2jiwb1 (2jiw B:437-593)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1754445Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies)
    5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology
  4. 1754446Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (2 families) (S)
  5. 1754478Family a.246.1.0: automated matches [254242] (1 protein)
    not a true family
  6. 1754479Protein automated matches [254554] (2 species)
    not a true protein
  7. 1754480Species Bacteroides thetaiotaomicron [TaxId:226186] [255269] (4 PDB entries)
  8. 1754482Domain d2jiwb1: 2jiw B:437-593 [148104]
    Other proteins in same PDB: d2jiwa2, d2jiwa3, d2jiwb2, d2jiwb3
    automated match to d2choa1
    complexed with beu

Details for d2jiwb1

PDB Entry: 2jiw (more details), 1.95 Å

PDB Description: bacteroides thetaiotaomicron gh84 o-glcnacase in complex with 2-acetylamino-2-deoxy-1-epivalienamine
PDB Compounds: (B:) o-glcnacase bt_4395

SCOPe Domain Sequences for d2jiwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jiwb1 a.246.1.0 (B:437-593) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
reesmdiqpaaerflkafkegknydkadfetlqytfermkesadillmntenkpliveit
pwvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfyidqtsnqnpyqpgvkt
atrvikplidrtfatvvkffnqkfnahldattdymph

SCOPe Domain Coordinates for d2jiwb1:

Click to download the PDB-style file with coordinates for d2jiwb1.
(The format of our PDB-style files is described here.)

Timeline for d2jiwb1: