Lineage for d2jiwa2 (2jiw A:127-436)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2095124Family c.1.8.10: alpha-D-glucuronidase/Hyaluronidase catalytic domain [82253] (4 proteins)
    Glycosyl hydrolase family 67, GH67; structurally related to GH20; contains extra C-terminal alpha-helical subdomain
  6. 2095175Protein automated matches [254553] (2 species)
    not a true protein
  7. 2095176Species Bacteroides thetaiotaomicron [TaxId:226186] [255268] (4 PDB entries)
  8. 2095177Domain d2jiwa2: 2jiw A:127-436 [148102]
    Other proteins in same PDB: d2jiwa1, d2jiwa3, d2jiwb1, d2jiwb3
    automated match to d2choa2
    complexed with beu

Details for d2jiwa2

PDB Entry: 2jiw (more details), 1.95 Å

PDB Description: bacteroides thetaiotaomicron gh84 o-glcnacase in complex with 2-acetylamino-2-deoxy-1-epivalienamine
PDB Compounds: (A:) o-glcnacase bt_4395

SCOPe Domain Sequences for d2jiwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jiwa2 c.1.8.10 (A:127-436) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
vryrgvvegfygtpwshqarlsqlkfygknkmntyiygpkddpyhsapnwrlpypdkeaa
qlqelvavanenevdfvwaihpgqdikwnkedrdlllakfekmyqlgvrsfavffddisg
egtnpqkqaellnyidekfaqvkpdinqlvmcpteynkswsnpngnylttlgdklnpsiq
imwtgdrvisditrdgiswinerikrpayiwwnfpvsdyvrdhlllgpvygndttiakem
sgfvtnpmehaesskiaiysvasyawnpakydtwqtwkdairtilpsaaeelecfamhns
dlgpnghgyr

SCOPe Domain Coordinates for d2jiwa2:

Click to download the PDB-style file with coordinates for d2jiwa2.
(The format of our PDB-style files is described here.)

Timeline for d2jiwa2: