| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies) 5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology |
Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (2 families) ![]() |
| Family a.246.1.0: automated matches [254242] (1 protein) not a true family |
| Protein automated matches [254554] (2 species) not a true protein |
| Species Bacteroides thetaiotaomicron [TaxId:226186] [255269] (4 PDB entries) |
| Domain d2jiwa1: 2jiw A:437-593 [148101] Other proteins in same PDB: d2jiwa2, d2jiwa3, d2jiwb2, d2jiwb3 automated match to d2choa1 complexed with beu |
PDB Entry: 2jiw (more details), 1.95 Å
SCOPe Domain Sequences for d2jiwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jiwa1 a.246.1.0 (A:437-593) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
reesmdiqpaaerflkafkegknydkadfetlqytfermkesadillmntenkpliveit
pwvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfyidqtsnqnpyqpgvkt
atrvikplidrtfatvvkffnqkfnahldattdymph
Timeline for d2jiwa1: