Class a: All alpha proteins [46456] (284 folds) |
Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies) 5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology |
Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (1 family) |
Family a.246.1.1: Hyaluronidase post-catalytic domain-like [140658] (2 proteins) |
Protein Glucosaminidase GH84 post-catalytic domain [140661] (1 species) |
Species Bacteroides thetaiotaomicron [TaxId:818] [140662] (7 PDB entries) Uniprot Q89ZI2 458-610! Uniprot Q89ZI2 458-611 |
Domain d2jiwa1: 2jiw A:437-589 [148101] Other proteins in same PDB: d2jiwa2, d2jiwa3, d2jiwb2, d2jiwb3 automatically matched to 2J4G A:437-589 complexed with beu |
PDB Entry: 2jiw (more details), 1.95 Å
SCOPe Domain Sequences for d2jiwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jiwa1 a.246.1.1 (A:437-589) Glucosaminidase GH84 post-catalytic domain {Bacteroides thetaiotaomicron [TaxId: 818]} reesmdiqpaaerflkafkegknydkadfetlqytfermkesadillmntenkpliveit pwvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfyidqtsnqnpyqpgvkt atrvikplidrtfatvvkffnqkfnahldattd
Timeline for d2jiwa1: