SCOPe 2.01: Domain d2jiwa1: 2jiw A:437-589

Lineage for d2jiwa1 (2jiw A:437-589)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies)
   5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology

4. Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (1 family)

5. Family a.246.1.1: Hyaluronidase post-catalytic domain-like [140658] (2 proteins)

6. Protein Glucosaminidase GH84 post-catalytic domain [140661] (1 species)

7. Species Bacteroides thetaiotaomicron [TaxId:818] [140662] (7 PDB entries)
   Uniprot Q89ZI2 458-610! Uniprot Q89ZI2 458-611

8. Domain d2jiwa1: 2jiw A:437-589 [148101]
   Other proteins in same PDB: d2jiwa2, d2jiwa3, d2jiwb2, d2jiwb3
   automatically matched to 2J4G A:437-589
   complexed with beu

Details for d2jiwa1

PDB Entry: 2jiw, 1.95 Å

PDB Description: bacteroides thetaiotaomicron gh84 o-glcnacase in complex with 2-acetylamino-2-deoxy-1-epivalienamine

PDB Compounds: (A:) o-glcnacase bt_4395

SCOPe Domain Sequences for d2jiwa1:

Sequence; same for both SEQRES and ATOM records:

>d2jiwa1 a.246.1.1 (A:437-589) Glucosaminidase GH84 post-catalytic domain {Bacteroides thetaiotaomicron [TaxId: 818]}
reesmdiqpaaerflkafkegknydkadfetlqytfermkesadillmntenkpliveit
pwvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfyidqtsnqnpyqpgvkt
atrvikplidrtfatvvkffnqkfnahldattd

Timeline for d2jiwa1:

• d2jiwa1 first appeared in SCOP 1.75
  
• d2jiwa1 appears in SCOPe 2.02
  
• d2jiwa1 appears in the current release, SCOPe 2.08