Lineage for d2jira1 (2jir A:601-723)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2802576Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2802649Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 2802680Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins)
    molybdopterine enzyme
  6. 2802723Protein Periplasmic nitrate reductase alpha chain, NapA [50706] (2 species)
  7. Species Desulfovibrio desulfuricans [TaxId:876] [50707] (5 PDB entries)
    dissimilatory nitrate reductase (NAP)
  8. 2802725Domain d2jira1: 2jir A:601-723 [148099]
    Other proteins in same PDB: d2jira2
    automated match to d2napa1
    complexed with cyn, mgd, mo, no2, sf4

Details for d2jira1

PDB Entry: 2jir (more details), 2.35 Å

PDB Description: a new catalytic mechanism of periplasmic nitrate reductase from desulfovibrio desulfuricans atcc 27774 from crystallographic and epr data and based on detailed analysis of the sixth ligand
PDB Compounds: (A:) periplasmic nitrate reductase

SCOPe Domain Sequences for d2jira1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jira1 b.52.2.2 (A:601-723) Periplasmic nitrate reductase alpha chain, NapA {Desulfovibrio desulfuricans [TaxId: 876]}
aaeepdaeyplyltsmrvidhwhtatmtgkvpelqkanpiafveineedaartgikhgds
vivetrrdamelparvsdvcrpgliavpffdpkklvnklfldatdpvsrepeykicaarv
rka

SCOPe Domain Coordinates for d2jira1:

Click to download the PDB-style file with coordinates for d2jira1.
(The format of our PDB-style files is described here.)

Timeline for d2jira1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2jira2