Lineage for d2jipa1 (2jip A:601-723)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1798408Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 1798462Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 1798493Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins)
    molybdopterine enzyme
  6. 1798536Protein Periplasmic nitrate reductase alpha chain, NapA [50706] (2 species)
  7. Species Desulfovibrio desulfuricans [TaxId:876] [50707] (5 PDB entries)
    dissimilatory nitrate reductase (NAP)
  8. 1798540Domain d2jipa1: 2jip A:601-723 [148095]
    Other proteins in same PDB: d2jipa2
    automated match to d2napa1
    complexed with mgd, mo, sf4, unx

Details for d2jipa1

PDB Entry: 2jip (more details), 2.3 Å

PDB Description: a new catalytic mechanism of periplasmic nitrate reductase from desulfovibrio desulfuricans atcc 27774 from crystallographic and epr data and based on detailed analysis of the sixth ligand
PDB Compounds: (A:) periplasmic nitrate reductase

SCOPe Domain Sequences for d2jipa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jipa1 b.52.2.2 (A:601-723) Periplasmic nitrate reductase alpha chain, NapA {Desulfovibrio desulfuricans [TaxId: 876]}
aaeepdaeyplyltsmrvidhwhtatmtgkvpelqkanpiafveineedaartgikhgds
vivetrrdamelparvsdvcrpgliavpffdpkklvnklfldatdpvsrepeykicaarv
rka

SCOPe Domain Coordinates for d2jipa1:

Click to download the PDB-style file with coordinates for d2jipa1.
(The format of our PDB-style files is described here.)

Timeline for d2jipa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2jipa2