Lineage for d2jioa2 (2jio A:4-600)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1387811Fold c.81: Formate dehydrogenase/DMSO reductase, domains 1-3 [53705] (1 superfamily)
    contains of two similar intertwined domains related by pseudo dyad; duplication
    core: 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. 1387812Superfamily c.81.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53706] (1 family) (S)
    molybdopterine enzyme
  5. 1387813Family c.81.1.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53707] (11 proteins)
    domain 1 (residues 1-55) binds Fe4S4 cluster in FDH but not DMSO reductase
  6. 1387856Protein Periplasmic nitrate reductase alpha chain [53717] (2 species)
  7. 1387857Species Desulfovibrio desulfuricans [TaxId:876] [53718] (8 PDB entries)
    dissimilatory nitrate reductase (NAP)
  8. 1387859Domain d2jioa2: 2jio A:4-600 [148094]
    Other proteins in same PDB: d2jioa1
    automatically matched to d2napa2
    complexed with mgd, mo, sf4, unx

Details for d2jioa2

PDB Entry: 2jio (more details), 2.2 Å

PDB Description: a new catalytic mechanism of periplasmic nitrate reductase from desulfovibrio desulfuricans atcc 27774 from crystallographic and epr data and based on detailed analysis of the sixth ligand
PDB Compounds: (A:) periplasmic nitrate reductase

SCOPe Domain Sequences for d2jioa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jioa2 c.81.1.1 (A:4-600) Periplasmic nitrate reductase alpha chain {Desulfovibrio desulfuricans [TaxId: 876]}
rpekwvkgvcrycgtgcgvlvgvkdgkavaiqgdpnnhnagllclkgsllipvlnskerv
tqplvrrhkggklepvswdealdlmasrfrssidmygpnsvawygsgqclteesyvanki
fkggfgtnnvdgnprlcmasavggyvtsfgkdepmgtyadidqatcffiigsntseahpv
lfrriarrkqvepgvkiivadprrtntsriadmhvafrpgtdlafmhsmawviineeldn
prfwqryvnfmdaegkpsdfegykaflenyrpekvaeicrvpveqiygaarafaesaatm
slwcmginqrvqgvfannlihnlhlitgqicrpgatsfsltgqpnacggvrdggalshll
pagraipnakhraemeklwglpegriapepgyhtvalfealgrgdvkcmiicetnpahtl
pnlnkvhkamshpesfivcieafpdavtleyadlvlppafwcerdgvygcgerrysltek
avdppgqcrptvntlvefarragvdpqlvnfrnaedvwnewrmvskgttydfwgmtrerl
rkesgliwpcpsedhpgtslryvrgqdpcvpadhpdrfffygkpdgraviwmrpakg

SCOPe Domain Coordinates for d2jioa2:

Click to download the PDB-style file with coordinates for d2jioa2.
(The format of our PDB-style files is described here.)

Timeline for d2jioa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2jioa1