Lineage for d2jioa1 (2jio A:601-723)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2412093Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2412166Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 2412374Family b.52.2.0: automated matches [191648] (1 protein)
    not a true family
  6. 2412375Protein automated matches [191195] (10 species)
    not a true protein
  7. 2412378Species Desulfovibrio desulfuricans [TaxId:876] [255266] (3 PDB entries)
  8. 2412380Domain d2jioa1: 2jio A:601-723 [148093]
    Other proteins in same PDB: d2jioa2
    automated match to d2v3va1
    complexed with mgd, mo, sf4, unx

Details for d2jioa1

PDB Entry: 2jio (more details), 2.2 Å

PDB Description: a new catalytic mechanism of periplasmic nitrate reductase from desulfovibrio desulfuricans atcc 27774 from crystallographic and epr data and based on detailed analysis of the sixth ligand
PDB Compounds: (A:) periplasmic nitrate reductase

SCOPe Domain Sequences for d2jioa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jioa1 b.52.2.0 (A:601-723) automated matches {Desulfovibrio desulfuricans [TaxId: 876]}
aaeepdaeyplyltsmrvidhwhtatmtgkvpelqkanpiafveineedaartgikhgds
vivetrrdamelparvsdvcrpgliavpffdpkklvnklfldatdpvsrepeykicaarv
rka

SCOPe Domain Coordinates for d2jioa1:

Click to download the PDB-style file with coordinates for d2jioa1.
(The format of our PDB-style files is described here.)

Timeline for d2jioa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2jioa2