Lineage for d2jioa1 (2jio A:601-723)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 804836Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 804878Superfamily b.52.2: ADC-like [50692] (3 families) (S)
  5. 804902Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins)
    molybdopterine enzyme
  6. 804945Protein Periplasmic nitrate reductase alpha chain, NapA [50706] (2 species)
  7. 804946Species Desulfovibrio desulfuricans [TaxId:876] [50707] (8 PDB entries)
    dissimilatory nitrate reductase (NAP)
  8. 804947Domain d2jioa1: 2jio A:601-723 [148093]
    Other proteins in same PDB: d2jioa2
    automatically matched to d2napa1
    complexed with mgd, mo, s, sf4

Details for d2jioa1

PDB Entry: 2jio (more details), 2.2 Å

PDB Description: a new catalytic mechanism of periplasmic nitrate reductase from desulfovibrio desulfuricans atcc 27774 from crystallographic and epr data and based on detailed analysis of the sixth ligand
PDB Compounds: (A:) periplasmic nitrate reductase

SCOP Domain Sequences for d2jioa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jioa1 b.52.2.2 (A:601-723) Periplasmic nitrate reductase alpha chain, NapA {Desulfovibrio desulfuricans [TaxId: 876]}
aaeepdaeyplyltsmrvidhwhtatmtgkvpelqkanpiafveineedaartgikhgds
vivetrrdamelparvsdvcrpgliavpffdpkklvnklfldatdpvsrepeykicaarv
rka

SCOP Domain Coordinates for d2jioa1:

Click to download the PDB-style file with coordinates for d2jioa1.
(The format of our PDB-style files is described here.)

Timeline for d2jioa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2jioa2