SCOP 1.75: Domain d2jima1: 2jim A:601-723

Lineage for d2jima1 (2jim A:601-723)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.2: ADC-like [50692] (3 families)

5. Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins)
   molybdopterine enzyme

6. Protein Periplasmic nitrate reductase alpha chain, NapA [50706] (2 species)

7. Species Desulfovibrio desulfuricans [TaxId:876] [50707] (8 PDB entries)
   dissimilatory nitrate reductase (NAP)

8. Domain d2jima1: 2jim A:601-723 [148091]
   Other proteins in same PDB: d2jima2
   automatically matched to d2napa1
   complexed with mgd, mo, s, sf4

Details for d2jima1

PDB Entry: 2jim, 2.45 Å

PDB Description: a new catalytic mechanism of periplasmic nitrate reductase from desulfovibrio desulfuricans atcc 27774 from crystallographic and epr data and based on detailed analysis of the sixth ligand

PDB Compounds: (A:) periplasmic nitrate reductase

SCOP Domain Sequences for d2jima1:

Sequence; same for both SEQRES and ATOM records:

>d2jima1 b.52.2.2 (A:601-723) Periplasmic nitrate reductase alpha chain, NapA {Desulfovibrio desulfuricans [TaxId: 876]}
aaeepdaeyplyltsmrvidhwhtatmtgkvpelqkanpiafveineedaartgikhgds
vivetrrdamelparvsdvcrpgliavpffdpkklvnklfldatdpvsrepeykicaarv
rka

Timeline for d2jima1:

• d2jima1 is new in SCOP 1.75
  
• d2jima1 appears in SCOPe 2.01
  
• d2jima1 appears in the current release, SCOPe 2.08