SCOPe 2.08: Domain d2jidb2: 2jid B:509-766

Lineage for d2jidb2 (2jid B:509-766)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (131 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188340] (99 PDB entries)

8. Domain d2jidb2: 2jid B:509-766 [148090]
   Other proteins in same PDB: d2jida1, d2jidb1
   automated match to d4n8db2
   complexed with gvb, nag

Details for d2jidb2

PDB Entry: 2jid, 2.8 Å

PDB Description: human dipeptidyl peptidase iv in complex with 1-(3,4-dimethoxy-phenyl) -3-m-tolyl-piperidine-4-ylamine

PDB Compounds: (B:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d2jidb2:

Sequence; same for both SEQRES and ATOM records:

>d2jidb2 c.69.1.0 (B:509-766) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslp

Timeline for d2jidb2:

• d2jidb2 first appeared in SCOP 1.75
  
• d2jidb2 appears in SCOPe 2.07