Lineage for d2jida2 (2jid A:509-766)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2509433Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2509434Protein automated matches [190543] (124 species)
    not a true protein
  7. 2509714Species Human (Homo sapiens) [TaxId:9606] [188340] (94 PDB entries)
  8. 2509801Domain d2jida2: 2jid A:509-766 [148088]
    Other proteins in same PDB: d2jida1, d2jidb1
    automated match to d4n8db2
    complexed with gvb, nag

Details for d2jida2

PDB Entry: 2jid (more details), 2.8 Å

PDB Description: human dipeptidyl peptidase iv in complex with 1-(3,4-dimethoxy-phenyl) -3-m-tolyl-piperidine-4-ylamine
PDB Compounds: (A:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d2jida2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jida2 c.69.1.0 (A:509-766) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslp

SCOPe Domain Coordinates for d2jida2:

Click to download the PDB-style file with coordinates for d2jida2.
(The format of our PDB-style files is described here.)

Timeline for d2jida2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2jida1