Lineage for d2jida1 (2jid A:39-508)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2419317Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 2419478Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) (S)
    automatically mapped to Pfam PF00930
  5. 2419479Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins)
    Pfam PF00930
  6. 2419762Protein automated matches [226889] (4 species)
    not a true protein
  7. 2419763Species Human (Homo sapiens) [TaxId:9606] [225823] (3 PDB entries)
  8. 2419768Domain d2jida1: 2jid A:39-508 [148087]
    Other proteins in same PDB: d2jida2, d2jidb2
    automated match to d4n8eb1
    complexed with gvb, nag

Details for d2jida1

PDB Entry: 2jid (more details), 2.8 Å

PDB Description: human dipeptidyl peptidase iv in complex with 1-(3,4-dimethoxy-phenyl) -3-m-tolyl-piperidine-4-ylamine
PDB Compounds: (A:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d2jida1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jida1 b.70.3.1 (A:39-508) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

SCOPe Domain Coordinates for d2jida1:

Click to download the PDB-style file with coordinates for d2jida1.
(The format of our PDB-style files is described here.)

Timeline for d2jida1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2jida2