SCOPe 2.07: Domain d2jica_: 2jic A:

Lineage for d2jica_ (2jic A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein Xylanase II [49979] (21 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Trichoderma longibrachiatum [TaxId:5548] [158986] (6 PDB entries)

8. Domain d2jica_: 2jic A: [148086]
   automated match to d1enxa_

Details for d2jica_

PDB Entry: 2jic, 1.5 Å

PDB Description: High resolution structure of xylanase-II from one micron beam experiment

PDB Compounds: (A:) xylanase-II

SCOPe Domain Sequences for d2jica_:

Sequence; same for both SEQRES and ATOM records:

>d2jica_ b.29.1.11 (A:) Xylanase II {Trichoderma longibrachiatum [TaxId: 5548]}
tiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvin
fsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrtq
rvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyfs
sgsasitvs

Timeline for d2jica_:

• d2jica_ first appeared in SCOP 1.75, called d2jica1
  
• d2jica_ appears in SCOPe 2.06
  
• d2jica_ appears in the current release, SCOPe 2.08