SCOP 1.75: Domain d2jica1: 2jic A:2-190

Lineage for d2jica1 (2jic A:2-190)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)

6. Protein Xylanase II [49979] (17 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Trichoderma longibrachiatum [TaxId:5548] [158986] (1 PDB entry)

8. Domain d2jica1: 2jic A:2-190 [148086]
   automatically matched to d1enxa_

Details for d2jica1

PDB Entry: 2jic, 1.5 Å

PDB Description: High resolution structure of xylanase-II from one micron beam experiment

PDB Compounds: (A:) xylanase-II

SCOP Domain Sequences for d2jica1:

Sequence; same for both SEQRES and ATOM records:

>d2jica1 b.29.1.11 (A:2-190) Xylanase II {Trichoderma longibrachiatum [TaxId: 5548]}
tiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvin
fsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrtq
rvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyfs
sgsasitvs

Timeline for d2jica1:

• d2jica1 is new in SCOP 1.75
  
• d2jica1 is called d2jica_ in SCOPe 2.01
  
• d2jica1 appears in the current release, SCOPe 2.08, called d2jica_