SCOPe 2.05: Domain d2jibb1: 2jib B:195-369

Lineage for d2jibb1 (2jib B:195-369)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins)
   N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold

6. Protein Oxalyl-CoA decarboxylase [142124] (1 species)

7. Species Oxalobacter formigenes [TaxId:847] [142125] (6 PDB entries)
   Uniprot P40149 195-369

8. Domain d2jibb1: 2jib B:195-369 [148083]
   Other proteins in same PDB: d2jiba2, d2jiba3, d2jibb2, d2jibb3
   automated match to d2c31a1
   complexed with adp, coa, mg, pge, tpp

Details for d2jibb1

PDB Entry: 2jib, 2.2 Å

PDB Description: x-ray structure of oxalyl-coa decarboxylase in complex with coenzyme-a

PDB Compounds: (B:) oxalyl-coa decarboxylase

SCOPe Domain Sequences for d2jibb1:

Sequence; same for both SEQRES and ATOM records:

>d2jibb1 c.31.1.3 (B:195-369) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]}
aqipaedaiaraadliknakrpvimlgkgaayaqcddeiralveetgipflpmgmakgll
pdnhpqsaaatrafalaqcdvcvligarlnwlmqhgkgktwgdelkkyvqidiqanemds
nqpiaapvvgdiksavsllrkalkgapkadaewtgalkakvdgnkaklagkmtae

Timeline for d2jibb1:

• d2jibb1 first appeared in SCOP 1.75
  
• d2jibb1 appears in SCOPe 2.04
  
• d2jibb1 appears in SCOPe 2.06
  
• d2jibb1 appears in the current release, SCOPe 2.08