Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology |
Protein Oxalyl-CoA decarboxylase [142209] (1 species) |
Species Oxalobacter formigenes [TaxId:847] [142210] (6 PDB entries) Uniprot P40149 370-552 |
Domain d2jiba3: 2jib A:370-565 [148082] Other proteins in same PDB: d2jiba1, d2jiba2, d2jibb1, d2jibb2 automated match to d2c31a3 complexed with adp, coa, mg, pge, tpp |
PDB Entry: 2jib (more details), 2.2 Å
SCOPe Domain Sequences for d2jiba3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jiba3 c.36.1.9 (A:370-565) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} tpsgmmnysnslgvvrdfmlanpdislvneganaldntrmivdmlkprkrldsgtwgvmg igmgycvaaaavtgkpviavegdsafgfsgmeleticrynlpvtviimnnggiykgnead pqpgvisctrltrgrydmmmeafggkgyvantpaelkaaleeavasgkpclinamidpda gvesgrikslnvvskv
Timeline for d2jiba3: