Lineage for d2ji9b1 (2ji9 B:195-369)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2862578Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2862579Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2862632Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins)
    N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold
  6. 2862803Protein Oxalyl-CoA decarboxylase [142124] (1 species)
  7. 2862804Species Oxalobacter formigenes [TaxId:847] [142125] (6 PDB entries)
    Uniprot P40149 195-369
  8. 2862810Domain d2ji9b1: 2ji9 B:195-369 [148077]
    Other proteins in same PDB: d2ji9a2, d2ji9a3, d2ji9b2, d2ji9b3
    automated match to d2c31a1
    complexed with adp, b3p, mg, tpw

Details for d2ji9b1

PDB Entry: 2ji9 (more details), 2.2 Å

PDB Description: x-ray structure of oxalyl-coa decarboxylase in complex with 3-deaza-thdp
PDB Compounds: (B:) oxalyl-coa decarboxylase

SCOPe Domain Sequences for d2ji9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ji9b1 c.31.1.3 (B:195-369) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]}
aqipaedaiaraadliknakrpvimlgkgaayaqcddeiralveetgipflpmgmakgll
pdnhpqsaaatrafalaqcdvcvligarlnwlmqhgkgktwgdelkkyvqidiqanemds
nqpiaapvvgdiksavsllrkalkgapkadaewtgalkakvdgnkaklagkmtae

SCOPe Domain Coordinates for d2ji9b1:

Click to download the PDB-style file with coordinates for d2ji9b1.
(The format of our PDB-style files is described here.)

Timeline for d2ji9b1: