Lineage for d2ji9a2 (2ji9 A:7-194)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1361462Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 1361463Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 1361464Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology
    automatically mapped to Pfam PF02776
  6. 1361562Protein Oxalyl-CoA decarboxylase [142205] (1 species)
  7. 1361563Species Oxalobacter formigenes [TaxId:847] [142206] (6 PDB entries)
    Uniprot P40149 7-194
  8. 1361570Domain d2ji9a2: 2ji9 A:7-194 [148075]
    Other proteins in same PDB: d2ji9a1, d2ji9a3, d2ji9b1, d2ji9b3
    automated match to d2c31a2
    complexed with adp, b3p, mg, tpw

Details for d2ji9a2

PDB Entry: 2ji9 (more details), 2.2 Å

PDB Description: x-ray structure of oxalyl-coa decarboxylase in complex with 3-deaza-thdp
PDB Compounds: (A:) oxalyl-coa decarboxylase

SCOPe Domain Sequences for d2ji9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ji9a2 c.36.1.5 (A:7-194) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]}
veltdgfhvlidalkmndidtmygvvgipitnlarmwqddgqrfysfrheqhagyaasia
gyiegkpgvcltvsapgflngvtslahattncfpmillsgssereivdlqqgdyeemdqm
nvarphckasfrinsikdipigiaravrtavsgrpggvyvdlpaklfgqtisveeankll
fkpidpap

SCOPe Domain Coordinates for d2ji9a2:

Click to download the PDB-style file with coordinates for d2ji9a2.
(The format of our PDB-style files is described here.)

Timeline for d2ji9a2: