Lineage for d2ji8b1 (2ji8 B:195-369)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2121033Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2121034Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2121061Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins)
    N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold
  6. 2121229Protein Oxalyl-CoA decarboxylase [142124] (1 species)
  7. 2121230Species Oxalobacter formigenes [TaxId:847] [142125] (6 PDB entries)
    Uniprot P40149 195-369
  8. 2121240Domain d2ji8b1: 2ji8 B:195-369 [148071]
    Other proteins in same PDB: d2ji8a2, d2ji8a3, d2ji8b2, d2ji8b3
    automated match to d2c31a1
    complexed with adp, fyn, mg, pge, tpp

Details for d2ji8b1

PDB Entry: 2ji8 (more details), 2.15 Å

PDB Description: x-ray structure of oxalyl-coa decarboxylase in complex with formyl-coa
PDB Compounds: (B:) oxalyl-coa decarboxylase

SCOPe Domain Sequences for d2ji8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ji8b1 c.31.1.3 (B:195-369) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]}
aqipaedaiaraadliknakrpvimlgkgaayaqcddeiralveetgipflpmgmakgll
pdnhpqsaaatrafalaqcdvcvligarlnwlmqhgkgktwgdelkkyvqidiqanemds
nqpiaapvvgdiksavsllrkalkgapkadaewtgalkakvdgnkaklagkmtae

SCOPe Domain Coordinates for d2ji8b1:

Click to download the PDB-style file with coordinates for d2ji8b1.
(The format of our PDB-style files is described here.)

Timeline for d2ji8b1: