SCOP 1.75: Domain d2ji7b3: 2ji7 B:370-552

Lineage for d2ji7b3 (2ji7 B:370-552)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins)
   the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology

6. Protein Oxalyl-CoA decarboxylase [142209] (1 species)

7. Species Oxalobacter formigenes [TaxId:847] [142210] (6 PDB entries)
   Uniprot P40149 370-552

8. Domain d2ji7b3: 2ji7 B:370-552 [148067]
   Other proteins in same PDB: d2ji7a1, d2ji7a2, d2ji7b1, d2ji7b2
   automatically matched to d2c31a3
   complexed with adp, b3p, mg, oxt, pge

Details for d2ji7b3

PDB Entry: 2ji7, 1.82 Å

PDB Description: x-ray structure of oxalyl-coa decarboxylase with covalent reaction intermediate

PDB Compounds: (B:) oxalyl-coa decarboxylase

SCOP Domain Sequences for d2ji7b3:

Sequence; same for both SEQRES and ATOM records:

>d2ji7b3 c.36.1.9 (B:370-552) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]}
tpsgmmnysnslgvvrdfmlanpdislvneganaldntrmivdmlkprkrldsgtwgvmg
igmgycvaaaavtgkpviavegdsafgfsgmeleticrynlpvtviimnnggiykgnead
pqpgvisctrltrgrydmmmeafggkgyvantpaelkaaleeavasgkpclinamidpda
gve

Timeline for d2ji7b3:

• d2ji7b3 is new in SCOP 1.75
  
• d2ji7b3 appears in SCOPe 2.01
  
• d2ji7b3 appears in the current release, SCOPe 2.08