Lineage for d2ji7a3 (2ji7 A:370-565)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1361462Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 1361463Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 1361745Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology
  6. 1361843Protein Oxalyl-CoA decarboxylase [142209] (1 species)
  7. 1361844Species Oxalobacter formigenes [TaxId:847] [142210] (6 PDB entries)
    Uniprot P40149 370-552
  8. 1361845Domain d2ji7a3: 2ji7 A:370-565 [148064]
    Other proteins in same PDB: d2ji7a1, d2ji7a2, d2ji7b1, d2ji7b2
    automated match to d2c31a3
    complexed with adp, b3p, mg, oxt, pge

Details for d2ji7a3

PDB Entry: 2ji7 (more details), 1.82 Å

PDB Description: x-ray structure of oxalyl-coa decarboxylase with covalent reaction intermediate
PDB Compounds: (A:) oxalyl-coa decarboxylase

SCOPe Domain Sequences for d2ji7a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ji7a3 c.36.1.9 (A:370-565) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]}
tpsgmmnysnslgvvrdfmlanpdislvneganaldntrmivdmlkprkrldsgtwgvmg
igmgycvaaaavtgkpviavegdsafgfsgmeleticrynlpvtviimnnggiykgnead
pqpgvisctrltrgrydmmmeafggkgyvantpaelkaaleeavasgkpclinamidpda
gvesgrikslnvvskv

SCOPe Domain Coordinates for d2ji7a3:

Click to download the PDB-style file with coordinates for d2ji7a3.
(The format of our PDB-style files is described here.)

Timeline for d2ji7a3: