![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
![]() | Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology |
![]() | Protein Oxalyl-CoA decarboxylase [142209] (1 species) |
![]() | Species Oxalobacter formigenes [TaxId:847] [142210] (6 PDB entries) Uniprot P40149 370-552 |
![]() | Domain d2ji6b3: 2ji6 B:370-565 [148061] Other proteins in same PDB: d2ji6a1, d2ji6a2, d2ji6b1, d2ji6b2 automated match to d2c31a3 complexed with adp, b3p, mg, oxk, pge, tpw |
PDB Entry: 2ji6 (more details), 2.06 Å
SCOPe Domain Sequences for d2ji6b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ji6b3 c.36.1.9 (B:370-565) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} tpsgmmnysnslgvvrdfmlanpdislvneganaldntrmivdmlkprkrldsgtwgvmg igmgycvaaaavtgkpviavegdsafgfsgmeleticrynlpvtviimnnggiykgnead pqpgvisctrltrgrydmmmeafggkgyvantpaelkaaleeavasgkpclinamidpda gvesgrikslnvvskv
Timeline for d2ji6b3: