Lineage for d2ji6a1 (2ji6 A:195-369)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 828384Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 828385Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (6 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 828414Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins)
    N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold
  6. 828507Protein Oxalyl-CoA decarboxylase [142124] (1 species)
  7. 828508Species Oxalobacter formigenes [TaxId:847] [142125] (6 PDB entries)
    Uniprot P40149 195-369
  8. 828513Domain d2ji6a1: 2ji6 A:195-369 [148056]
    Other proteins in same PDB: d2ji6a2, d2ji6a3, d2ji6b2, d2ji6b3
    automatically matched to d2c31a1
    complexed with adp, b3p, mg, oxk, pge, tpw

Details for d2ji6a1

PDB Entry: 2ji6 (more details), 2.06 Å

PDB Description: x-ray structure of oxalyl-coa decarboxylase in complex with 3-deaza- thdp and oxalyl-coa
PDB Compounds: (A:) oxalyl-coa decarboxylase

SCOP Domain Sequences for d2ji6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ji6a1 c.31.1.3 (A:195-369) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]}
aqipaedaiaraadliknakrpvimlgkgaayaqcddeiralveetgipflpmgmakgll
pdnhpqsaaatrafalaqcdvcvligarlnwlmqhgkgktwgdelkkyvqidiqanemds
nqpiaapvvgdiksavsllrkalkgapkadaewtgalkakvdgnkaklagkmtae

SCOP Domain Coordinates for d2ji6a1:

Click to download the PDB-style file with coordinates for d2ji6a1.
(The format of our PDB-style files is described here.)

Timeline for d2ji6a1: