| Class b: All beta proteins [48724] (174 folds) |
| Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.22.1: TNF-like [49842] (2 families) ![]() |
| Family b.22.1.1: TNF-like [49843] (15 proteins) |
| Protein Complement c1q globular head, B chain [101615] (1 species) hetrotrimer of A, B and C chains |
| Species Human (Homo sapiens) [TaxId:9606] [101616] (3 PDB entries) |
| Domain d2jg9e1: 2jg9 E:92-223 [148049] Other proteins in same PDB: d2jg9a1, d2jg9c1, d2jg9d1, d2jg9f1 automatically matched to d1pk6b_ complexed with ca |
PDB Entry: 2jg9 (more details), 1.9 Å
SCOPe Domain Sequences for d2jg9e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jg9e1 b.22.1.1 (E:92-223) Complement c1q globular head, B chain {Human (Homo sapiens) [TaxId: 9606]}
tqkiafsatrtinvplrrdqtirfdhvitnmnnnyeprsgkftckvpglyyftyhassrg
nlcvnlmrgreraqkvvtfcdyayntfqvttggmvlkleqgenvflqatdknsllgmega
nsifsgfllfpd
Timeline for d2jg9e1: