Lineage for d2jg9b1 (2jg9 B:92-223)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 943163Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 943164Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 943165Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 943218Protein Complement c1q globular head, B chain [101615] (1 species)
    hetrotrimer of A, B and C chains
  7. 943219Species Human (Homo sapiens) [TaxId:9606] [101616] (3 PDB entries)
  8. 943221Domain d2jg9b1: 2jg9 B:92-223 [148046]
    Other proteins in same PDB: d2jg9a1, d2jg9c1, d2jg9d1, d2jg9f1
    automatically matched to d1pk6b_
    complexed with ca

Details for d2jg9b1

PDB Entry: 2jg9 (more details), 1.9 Å

PDB Description: crystallographic structure of human c1q globular heads (p1)
PDB Compounds: (B:) complement c1q subcomponent subunit b

SCOPe Domain Sequences for d2jg9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jg9b1 b.22.1.1 (B:92-223) Complement c1q globular head, B chain {Human (Homo sapiens) [TaxId: 9606]}
tqkiafsatrtinvplrrdqtirfdhvitnmnnnyeprsgkftckvpglyyftyhassrg
nlcvnlmrgreraqkvvtfcdyayntfqvttggmvlkleqgenvflqatdknsllgmega
nsifsgfllfpd

SCOPe Domain Coordinates for d2jg9b1:

Click to download the PDB-style file with coordinates for d2jg9b1.
(The format of our PDB-style files is described here.)

Timeline for d2jg9b1: