Lineage for d2jg8e1 (2jg8 E:92-223)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2386843Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2386844Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2386845Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 2386904Protein Complement c1q globular head, B chain [101615] (1 species)
    hetrotrimer of A, B and C chains
  7. 2386905Species Human (Homo sapiens) [TaxId:9606] [101616] (3 PDB entries)
  8. 2386910Domain d2jg8e1: 2jg8 E:92-223 [148043]
    Other proteins in same PDB: d2jg8a1, d2jg8c1, d2jg8d1, d2jg8f1
    automatically matched to d1pk6b_
    complexed with ca, nag, sep

Details for d2jg8e1

PDB Entry: 2jg8 (more details), 2.05 Å

PDB Description: crystallographic structure of human c1q globular heads complexed to phosphatidyl-serine
PDB Compounds: (E:) complement c1q subcomponent subunit b

SCOPe Domain Sequences for d2jg8e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jg8e1 b.22.1.1 (E:92-223) Complement c1q globular head, B chain {Human (Homo sapiens) [TaxId: 9606]}
tqkiafsatrtinvplrrdqtirfdhvitnmnnnyeprsgkftckvpglyyftyhassrg
nlcvnlmrgreraqkvvtfcdyayntfqvttggmvlkleqgenvflqatdknsllgmega
nsifsgfllfpd

SCOPe Domain Coordinates for d2jg8e1:

Click to download the PDB-style file with coordinates for d2jg8e1.
(The format of our PDB-style files is described here.)

Timeline for d2jg8e1: